PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV35611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family ZF-HD
Protein Properties Length: 345aa    MW: 37542.8 Da    PI: 9.1428
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV35611.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.5e-32132187359
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++ Y+eClkNhAa +Ggh+vDGCgEfm+s geegt++a++CaAC+CHR+FHR+ev+ 
   KZV35611.1 132 SIIYRECLKNHAAGIGGHVVDGCGEFMAS-GEEGTPEAVRCAACDCHRSFHRKEVKG 187
                  679*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.1E-29133185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-20135187IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.26135184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.0E-29135185IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.91E-19268342IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-30271343IPR009057Homeodomain-like
PROSITE profilePS500718.746279343IPR001356Homeobox domain
TIGRFAMsTIGR015659.3E-27281338IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MERRGQARDM LGIQGSMNYN IPPPTSQGSP VKLPLAPLVA TSADRRGNAT VSTRRGSSIF  60
SPTQILDNHN HPPPHLRHQV STPPPQPTPD PDPAPSAAAA AGESSNLKAS ATQPQVSPPP  120
AAAADCSDTS SSIIYRECLK NHAAGIGGHV VDGCGEFMAS GEEGTPEAVR CAACDCHRSF  180
HRKEVKGEPP QQPYIHYPCN PNHNTGNSNI HRPNPLLHTL NTPRGGHLQN LHHKHSTQPT  240
MVNFGGSTGG AAAESSSEDL NMFHSGSGGH ASTQPSISGS KKRFRTKFSQ EQKDRMHEFA  300
ERLEWRIQKQ DDQQVQQFCS EIGVRRQVFK VWMHNNKQAM KKKQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-242803391675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.11e-131PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A068U3224e-94A0A068U322_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-55homeobox protein 24